PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G10770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9034.68 Da    PI: 10.4073
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G10770.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.71.3e-171050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     ri n+ +r  tf kR++g+ KKA EL +LC++e ++i++++
  LPERR02G10770.1 10 RILNDAQRRATFKKRLKGLTKKATELATLCGVEMCLIVYGE 50
                     899************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.0E-14161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.899150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-21178IPR002100Transcription factor, MADS-box
CDDcd002661.38E-21280No hitNo description
PRINTSPR004044.1E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-171050IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MARKRVKLQR ILNDAQRRAT FKKRLKGLTK KATELATLCG VEMCLIVYGE GAVEATEVWP  60
SVPEATSVLE RFKAMPDLDR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225RKRVKLQRILNDAQRRATFKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629573.16e-34PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D9VEZ51e-52A0A0D9VEZ5_9ORYZ; Uncharacterized protein
STRINGOB03G33030.14e-39(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.25e-20M-type_MADS family protein